PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_5DEA5C9E3.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 497aa    MW: 52829 Da    PI: 8.1601
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_5DEA5C9E3.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.11.4e-31229285259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkve+++ d+++ ei+Y+g+Hnh+
  Traes_5DS_5DEA5C9E3.1 229 DDGYNWRKYGQKVVKGSDCPRSYYKCTHPSCPVKKKVEHAE-DGQISEIIYKGKHNHQ 285
                            8**************************************99.***************8 PP

2WRKY1084.6e-34385443159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe
  Traes_5DS_5DEA5C9E3.1 385 LDDGYRWRKYGQKVVKGNPHPRSYYKCTFAGCNVRKHIERASSDPKAVITTYEGKHNHE 443
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-28225287IPR003657WRKY domain
SuperFamilySSF1182905.1E-25227287IPR003657WRKY domain
SMARTSM007741.1E-33228286IPR003657WRKY domain
PfamPF031062.8E-24229285IPR003657WRKY domain
PROSITE profilePS5081123.192229287IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.5E-37371445IPR003657WRKY domain
SuperFamilySSF1182902.88E-29377445IPR003657WRKY domain
PROSITE profilePS5081137.413380445IPR003657WRKY domain
SMARTSM007747.0E-40385444IPR003657WRKY domain
PfamPF031064.1E-26386443IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSARPPPPPR PRLSLPPRST GESLFSGTGD ASPGPLTLAS ALFPSDADAD AGGGGGGSGA  60
SSGAGPTSFT QLLIGSLSQP PPHQQQQQQQ ERGRGGVARA GPALSVAPPA GAAVFTVPPG  120
LSPSGFFDSP GLIFSPAMGG FGMSHQQALA QVTAQASHSP HRMFDHTEQP SFSAAATSSG  180
ALQNMSSAAN VAEMSEMATT ISNNEHAAFQ SAEASHRYQV PAPVDKPADD GYNWRKYGQK  240
VVKGSDCPRS YYKCTHPSCP VKKKVEHAED GQISEIIYKG KHNHQRPPNK RAKDGSSSAA  300
EQNEQSNDTA SGLSGVRRDQ EAVYGMSEQL SGLSDGDDKD DGESRPNEVD DRENDCKRRN  360
IQISSQKALT ESKIIVQTTS EVDLLDDGYR WRKYGQKVVK GNPHPRSYYK CTFAGCNVRK  420
HIERASSDPK AVITTYEGKH NHEPPVGRGS NQNGGNSNRS QQKGPNSMSS NQASHTGTDL  480
GNIKQGQIGV LQFKREE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-39229445877Probable WRKY transcription factor 4
2lex_A7e-39229445877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2168400.0JX216840.1 Hordeum vulgare WRKY61 protein (WRKY61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576063.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-126WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW5G2K80.0W5G2K8_WHEAT; Uncharacterized protein
STRINGBRADI4G06690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-113WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]